PDB entry 1hxb

View 1hxb on RCSB PDB site
Description: HIV-1 proteinase complexed with RO 31-8959
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, aspartyl protease
Deposited on 1996-09-13, released 1997-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 (CLONE 12) [TaxId:11679]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
  Domains in SCOPe 2.06: d1hxba_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 (CLONE 12) [TaxId:11679]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
  Domains in SCOPe 2.06: d1hxbb_
• Heterogens: ROC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hxbA (A:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hxbB (B:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf