PDB entry 1hx6

View 1hx6 on RCSB PDB site
Description: p3, the major coat protein of the lipid-containing bacteriophage prd1.
Deposited on 2001-01-11, released 2001-01-24
The last revision prior to the SCOP 1.57 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.19
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hx6A (A:)
    lrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvta
    aitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmv
    tdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkl
    efannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplidl
    stlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanfs
    dtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarll
    mgyeyftsrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hx6B (B:)
    qqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflv
    kvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapfl
    ssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskq
    rlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilp
    lidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrt
    anfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqn
    arllmgyeyftsrt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hx6C (C:)
    alrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvt
    aaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssm
    vtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlk
    lefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplid
    lstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanf
    sdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarl
    lmgyeyftsrt