PDB entry 1hx5

View 1hx5 on RCSB PDB site
Description: Crystal structure of M. tuberculosis chaperonin-10
Class: chaperone
Keywords: beta barrel, mobile loop, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, CHAPERONE
Deposited on 2001-01-11, released 2001-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV3418C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hx5a_
  • Chain 'B':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV3418C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hx5b_
  • Chain 'C':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV3418C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hx5c_
  • Chain 'D':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV3418C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hx5d_
  • Chain 'E':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV3418C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hx5e_
  • Chain 'F':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV3418C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hx5f_
  • Chain 'G':
    Compound: 10 kda chaperonin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV3418C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hx5g_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hx5A (A:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx5A (A:)
    ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
    teikyngeeylilsardvlavv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hx5B (B:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx5B (B:)
    ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
    teikyngeeylilsardvlavv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hx5C (C:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx5C (C:)
    ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
    teikyngeeylilsardvlavv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hx5D (D:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx5D (D:)
    ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
    teikyngeeylilsardvlavv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hx5E (E:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx5E (E:)
    ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
    teikyngeeylilsardvlavv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hx5F (F:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx5F (F:)
    ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
    teikyngeeylilsardvlavv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1hx5G (G:)
    akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
    dvaegdtviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx5G (G:)
    ikpledkilvqattasglvippqegtvvavgpgrwdedgekripldvaegdtviyskygg
    teikyngeeylilsardvlavv