PDB entry 1hx1

View 1hx1 on RCSB PDB site
Description: crystal structure of a bag domain in complex with the hsc70 ATPase domain
Class: chaperone/chaperone inhibitor
Keywords: protein-protein complex, apoptosis, protein folding, molecular chaperone, nucleotide exchange factor, chaperone-chaperone inhibitor complex
Deposited on 2001-01-11, released 2001-03-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.234
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock 70 kDa protein 8
    Species: Bos taurus [TaxId:9913]
    Gene: HSPA8, HSC70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hx1a1, d1hx1a2
  • Chain 'B':
    Compound: BAG family molecular chaperone regulator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BAG1, HAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99933 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d1hx1b1, d1hx1b2
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hx1A (A:)
    msyyhhhhhhdydpttenlyfqgpavgidlgttyscvgvfqhgkveiiandqgnrttpsy
    vaftdterligdaaknqvamnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrp
    kvqveykgetksfypeevssmvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkda
    gtiaglnvlriineptaaaiaygldkkvgaernvlifdlgggtfdvsiltiedgifevks
    tagdthlggedfdnrmvnhfiaefkrkhkkdisenkravrrlrtacerakrtlssstqas
    ieidslyegidfytsitrarfeelnadlfrgtldpvekalrdakldksqihdivlvggst
    ripkiqkllqdffngkelnksinpdeavaygaavqaails
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx1A (A:)
    pavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt
    ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl
    tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg
    ldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiae
    fkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfee
    lnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksin
    pdeavaygaavqaails
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hx1B (B:)
    gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
    tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqete
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx1B (B:)
    gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
    tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqe