PDB entry 1hx0

View 1hx0 on RCSB PDB site
Description: Structure of pig pancreatic alpha-amylase complexed with the "truncate" acarbose molecule (pseudotrisaccharide)
Class: hydrolase
Keywords: Alpha-amylase, inhibitor, carbohydrate, pancreas, HYDROLASE
Deposited on 2001-01-11, released 2001-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.108
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha amylase (ppa)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00690 (0-495)
      • engineered (0)
      • conflict (122)
      • conflict (242)
      • conflict (309)
      • conflict (322)
      • conflict (403)
    Domains in SCOPe 2.07: d1hx0a1, d1hx0a2
  • Heterogens: MAL, CL, CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hx0A (A:)
    eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgnrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl