PDB entry 1hwz

View 1hwz on RCSB PDB site
Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and GTP
Class: oxidoreductase
Keywords: glutamate dehydrogenase, allostery, NADPH, OXIDOREDUCTASE
Deposited on 2001-01-10, released 2001-01-31
Made obsolete by 6dhd on 2018-07-25

The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.25
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwza1, d1hwza2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwzb1, d1hwzb2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwzc1, d1hwzc2
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwzd1, d1hwzd2
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwze1, d1hwze2
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwzf1, d1hwzf2
  • Heterogens: GLU, NDP, GTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwzA (A:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwzB (B:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwzC (C:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwzD (D:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwzE (E:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwzF (F:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft