PDB entry 1hwy

View 1hwy on RCSB PDB site
Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate
Class: oxidoreductase
Keywords: allostery, glutamate dehydrogenase, NAD, OXIDOREDUCTASE
Deposited on 2001-01-10, released 2001-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.06: d1hwya1, d1hwya2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.06: d1hwyb1, d1hwyb2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.06: d1hwyc1, d1hwyc2
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.06: d1hwyd1, d1hwyd2
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.06: d1hwye1, d1hwye2
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.06: d1hwyf1, d1hwyf2
  • Heterogens: PO4, AKG, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyA (A:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyB (B:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyC (C:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyD (D:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyE (E:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyF (F:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft