PDB entry 1hwx

View 1hwx on RCSB PDB site
Description: crystal structure of bovine liver glutamate dehydrogenase complexed with GTP, nadh, and l-glutamic acid
Class: oxidoreductase
Keywords: glutamate dehydrogenase, allostery, abortive complex, oxidoreductase
Deposited on 2001-01-10, released 2001-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.17
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwxa3, d1hwxa4
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwxb3, d1hwxb4
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwxc3, d1hwxc4
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwxd3, d1hwxd4
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwxe3, d1hwxe4
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00366 (0-500)
      • see remark 999 (199-201)
      • see remark 999 (220-221)
    Domains in SCOPe 2.07: d1hwxf3, d1hwxf4
  • Heterogens: GLU, GTP, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwxA (A:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwxB (B:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwxC (C:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwxD (D:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwxE (E:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwxF (F:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft