PDB entry 1hwn

View 1hwn on RCSB PDB site
Description: ebulin complexed with galactose, trigonal crystal form
Deposited on 2001-01-09, released 2001-01-24
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-18, with a file datestamp of 2001-04-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.264
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwnA (A:)
    idypsvsfnlagaksttyrdflknlrdrvatgtyevnglpvlrresevqvknrfvlvrlt
    nyngdtvtsavdvtnlylvafsangnsyffkdatelqksnlflgttqhtlsftgnydnle
    taagtrresielgpnpldgaitslwydggvarsllvliqmvpeaarfryieqevrrslqq
    ltsftpnalmlsmennwssmslevqlsgdnvspfsgtvqlqnydhtprlvdnfeelykit
    giaillfrcvatkt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwnB (B:)
    getcaipapftrrivgrdglcvdvrngydtdgtpiqlwpcgtqrnqqwtfyndktirsmg
    kcmtanglnsgsyimitdcstaaedatkwevlidgsiinpssglvmtapsgasrttllle
    nnihaasqgwtvsndvqpiatlivgynemclqangennnvwmedcdvtsvqqqwalfddr
    tirvnnsrglcvtsngyvskdlivirkcqglatqrwffnsdgsvvnlkstrvmdvkesdv
    slqeviifpatgnpnqqwrtqvp