PDB entry 1hwm

View 1hwm on RCSB PDB site
Description: ebulin,orthorhombic crystal form model
Deposited on 2001-01-09, released 2001-01-24
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-18, with a file datestamp of 2001-04-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.194
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwmA (A:)
    idypsvsfnlagaksttyrdflknlrdrvatgtyevnglpvlrresevqvknrfvlvrlt
    nyngdtvtsavdvtnlylvafsangnsyffkdatelqksnlflgttqhtlsftgnydnle
    taagtrresielgpnpldgaitslwydggvarsllvliqmvpeaarfryieqevrrslqq
    ltsftpnalmlsmennwssmslevqlsgdnvspfsgtvqlqnydhtprlvdnfeelykit
    giaillfrcva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwmB (B:)
    etcaipapftrrivgrdglcvdvrngydtdgtpiqlwpcgtqrnqqwtfyndktirsmgk
    cmtanglnsgsyimitdcstaaedatkwevlidgsiinpssglvmtapsgasrttlllen
    nihaasqgwtvsndvqpiatlivgynemclqangennnvwmedcdvtsvqqqwalfddrt
    irvnnsrglcvtsngyvskdlivirkcqglatqrwffnsdgsvvnlkstrvmdvkesdvs
    lqeviifpatgnpnqqwrtqvpqi