PDB entry 1hvx

View 1hvx on RCSB PDB site
Description:
Deposited on 2001-01-08, released 2001-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-31, with a file datestamp of 2001-01-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.154
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1hvxa1, d1hvxa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvxA (A:)
    aapfngtmmqyfewylpddgtlwtkvaneannlsslgitalwlppaykgtsrsdvgygvy
    dlydlgefnqkgavrtkygtkaqylqaiqaahaagmqvyadvvfdhkggadgtewvdave
    vnpsdrnqeisgtyqiqawtkfdfpgrgntyssfkwrwyhfdgvdwdesrklsriykfrg
    igkawdwevdtengnydylmyadldmdhpevvtelkswgkwyvnttnidgfrldavkhik
    fsffpdwlsyvrsqtgkplftvgeywsydinklhnyimktngtmslfdaplhnkfytask
    sggtfdmrtlmtntlmkdqptlavtfvdnhdtepgqalqswvdpwfkplayafiltrqeg
    ypcvfygdyygipqynipslkskidplliarrdyaygtqhdyldhsdiigwtregvtekp
    gsglaalitdgpggskwmyvgkqhagkvfydltgnrsdtvtinsdgwgefkvnggsvsvw
    vpr