PDB entry 1hvu

View 1hvu on RCSB PDB site
Description:
Deposited on 1998-06-30, released 1999-01-13
The last revision prior to the SCOP 1.71 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 4.75 Å
R-factor: 0.34
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1hvua1, d1hvua2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1hvub_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1hvud1, d1hvud2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1hvue_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1hvug1, d1hvug2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1hvuh_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1hvuj1, d1hvuj2
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1hvuk_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvuA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hvuB (B:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
    vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
    enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
    vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
    lwy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hvuB (B:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrhpdkwtvqpivlpekdswtvndiqklvgklnwa
    sqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdlia
    eiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktp
    kfklpiqketwetwwteywqatwipewefvntpplvklwy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvuD (D:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hvuE (E:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
    vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
    enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
    vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
    lwy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hvuE (E:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrhpdkwtvqpivlpekdswtvndiqklvgklnwa
    sqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdlia
    eiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktp
    kfklpiqketwetwwteywqatwipewefvntpplvklwy
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvuG (G:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1hvuH (H:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
    vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
    enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
    vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
    lwy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hvuH (H:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrhpdkwtvqpivlpekdswtvndiqklvgklnwa
    sqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdlia
    eiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktp
    kfklpiqketwetwwteywqatwipewefvntpplvklwy
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvuJ (J:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1hvuK (K:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
    vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
    enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
    vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
    lwy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hvuK (K:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrhpdkwtvqpivlpekdswtvndiqklvgklnwa
    sqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdlia
    eiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktp
    kfklpiqketwetwwteywqatwipewefvntpplvklwy