PDB entry 1hvs

View 1hvs on RCSB PDB site
Description: structural basis of drug resistance for the v82a mutant of hiv-1 protease: backbone flexibility and subsite repacking
Class: hydrolase (acid protease)
Keywords: hydrolase (acid protease)
Deposited on 1994-11-17, released 1995-02-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.15
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • conflict (81)
    Domains in SCOPe 2.04: d1hvsa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • conflict (81)
    Domains in SCOPe 2.04: d1hvsb_
  • Heterogens: A77

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvsA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpaniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvsB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpaniigrnlltqigctlnf