PDB entry 1hvq

View 1hvq on RCSB PDB site
Description: crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor
Class: hydrolase
Keywords: glycosidase, chitin degradation, multifunctional enzyme, hydrolase
Deposited on 1994-10-13, released 1995-12-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.144
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hevamine a
    Species: Hevea brasiliensis [TaxId:3981]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1hvqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvqA (A:)
    ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
    sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
    gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
    qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
    peikkspkyggvmlwskfyddkngysssildsv