PDB entry 1hvh
View 1hvh on RCSB PDB site
Description: nonpeptide cyclic cyanoguanidines as hiv protease inhibitors
Class: acid protease
Keywords: hydrolase, acid protease
Deposited on
1997-12-13, released
1998-12-30
The last revision prior to the SCOP 1.75 freeze date was dated
1999-04-06, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1hvha_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1hvhb_ - Heterogens: Q82, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1hvhA (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1hvhB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf