PDB entry 1hve

View 1hve on RCSB PDB site
Description: structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
Deposited on 1994-06-29, released 1995-03-31
The last revision prior to the SCOP 1.57 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.164
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1hve__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hve_ (-)
    lrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgrd
    llddlkseltgkfqklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeelra
    ikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqage
    lkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvksi
    rsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgdt
    sgdykkallllc