PDB entry 1hvc

View 1hvc on RCSB PDB site
Description: crystal structure of a tethered dimer of hiv-1 protease complexed with an inhibitor
Class: hydrolase(acid protease)
Keywords: hydrolase(acid protease)
Deposited on 1994-06-22, released 1994-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: synthetic gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hvca1, d1hvca2
  • Heterogens: A79, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvcA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnfggssgpqitlwqrplvtikig
    gqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvl
    vgptpvniigrnlltqigctlnf