PDB entry 1hvc

View 1hvc on RCSB PDB site
Description: crystal structure of a tethered dimer of hiv-1 protease complexed with an inhibitor
Deposited on 1994-06-22, released 1994-10-15
The last revision prior to the SCOP 1.69 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: -
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1hvc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvc_ (-)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnfggssgpqitlwqrplvtikig
    gqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvl
    vgptpvniigrnlltqigctlnf