PDB entry 1hvb

View 1hvb on RCSB PDB site
Description: crystal structure of streptomyces r61 dd-peptidase complexed with a novel cephalosporin analog of cell wall peptidoglycan
Class: hydrolase
Keywords: Protein-cephalosporin complex, HYDROLASE
Deposited on 2001-01-08, released 2001-02-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.114
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Streptomyces sp. [TaxId:31952]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hvba_
  • Heterogens: CEH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hvbA (A:)
    adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
    gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
    aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
    teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
    isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
    tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hvbA (A:)
    dlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvg
    svtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfa
    qtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvat
    eyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavi
    sstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgt
    vqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp