PDB entry 1hv9

View 1hv9 on RCSB PDB site
Description: structure of e. coli glmu: analysis of pyrophosphorylase and acetyltransferase active sites
Class: transferase
Keywords: left-handed parallel beta-helix, TRANSFERASE
Deposited on 2001-01-08, released 2001-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.211
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: glmU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hv9a1, d1hv9a2
  • Chain 'B':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: glmU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hv9b1, d1hv9b2
  • Heterogens: CO, COA, UD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hv9A (A:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgsk
    aghltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgat
    iaagttvtrnvgenalaisrvpqtqkegwrrpvkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hv9A (A:)
    namsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdllk
    qalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakpq
    ggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkrw
    lakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqseq
    aeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvi
    gddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskagh
    ltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaa
    gttvtrnvgenalaisrvpqtqkegwrrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hv9B (B:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgsk
    aghltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgat
    iaagttvtrnvgenalaisrvpqtqkegwrrpvkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hv9B (B:)
    nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
    kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
    qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
    wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
    qaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsv
    igddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskag
    hltylgdaeigdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatia
    agttvtrnvgenalaisrvpqtqkegwrrp