PDB entry 1hv4

View 1hv4 on RCSB PDB site
Description: crystal structure analysis of bar-head goose hemoglobin (deoxy form)
Class: oxygen storage/transport
Keywords: allosteric mechanism, oxygen transport, heme, respiratory protein
Deposited on 2001-01-07, released 2001-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2001-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha-a chain
    Species: Anser indicus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hv4a_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Anser indicus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hv4b_
  • Chain 'C':
    Compound: hemoglobin alpha-a chain
    Species: Anser indicus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hv4c_
  • Chain 'D':
    Compound: hemoglobin beta chain
    Species: Anser indicus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hv4d_
  • Chain 'E':
    Compound: hemoglobin alpha-a chain
    Species: Anser indicus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hv4e_
  • Chain 'F':
    Compound: hemoglobin beta chain
    Species: Anser indicus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hv4f_
  • Chain 'G':
    Compound: hemoglobin alpha-a chain
    Species: Anser indicus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hv4g_
  • Chain 'H':
    Compound: hemoglobin beta chain
    Species: Anser indicus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hv4h_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv4A (A:)
    vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
    kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae
    vhasldkflcavgtvltakyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv4B (B:)
    vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
    eftpdcqaawqklvrvvahalarkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv4C (C:)
    vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
    kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae
    vhasldkflcavgtvltakyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv4D (D:)
    vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
    eftpdcqaawqklvrvvahalarkyh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv4E (E:)
    vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
    kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae
    vhasldkflcavgtvltakyr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv4F (F:)
    vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
    eftpdcqaawqklvrvvahalarkyh
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv4G (G:)
    vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
    kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae
    vhasldkflcavgtvltakyr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv4H (H:)
    vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
    eftpdcqaawqklvrvvahalarkyh