PDB entry 1hv2

View 1hv2 on RCSB PDB site
Description: solution structure of yeast elongin c in complex with a von hippel-lindau peptide
Class: signaling protein
Keywords: protein-peptide complex, SIGNALING PROTEIN
Deposited on 2001-01-05, released 2001-09-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: elongin c
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03071 (0-98)
  Domains in SCOPe 2.05: d1hv2a_
• Chain 'B':
  Compound: von hippel-lindau disease tumor suppressor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40338 (0-14)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hv2A (A:)
  msqdfvtlvskddkeyeisrsaamisptlkamiegpfreskgrielkqfdshilekavey
  lnynlkysgvsedddeipefeiptemslelllaadylsi
  

  
  
• Chain 'B':
  No sequence available.