PDB entry 1hv1

View 1hv1 on RCSB PDB site
Description: dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase
Class: hydrolase
Keywords: beta sheet
Deposited on 2001-01-05, released 2001-09-14
The last revision prior to the SCOP 1.73 freeze date was dated 2001-09-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Bacillus circulans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09850 (0-184)
      • engineered (126)
    Domains in SCOP 1.73: d1hv1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hv1A (A:)
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftaywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw