PDB entry 1hv0

View 1hv0 on RCSB PDB site
Description: dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase
Class: hydrolase
Keywords: beta sheet, hydrolase
Deposited on 2001-01-05, released 2001-09-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09850 (0-184)
      • engineered (79)
    Domains in SCOPe 2.01: d1hv0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv0A (A:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyfvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw