PDB entry 1huw

View 1huw on RCSB PDB site
Description: the crystal structure of affinity-matured human growth hormone at 2 angstroms resolution
Class: hormone
Keywords: hormone
Deposited on 1993-09-22, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human growth hormone
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01241 (0-190)
      • engineered (9)
      • engineered (13)
      • engineered (17)
      • engineered (20)
      • engineered (40-41)
      • engineered (44-45)
      • engineered (53)
      • engineered (63)
      • engineered (166)
      • engineered (170)
      • engineered (173)
      • engineered (175)
      • engineered (178)
    Domains in SCOPe 2.08: d1huwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1huwA (A:)
    fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt
    psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg
    iqtlmgrledgsprtgqifkqtyskfdtnshnddallknygllycfnkdmskvstylrtv
    qcrsvegscgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1huwA (A:)
    fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt
    psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg
    iqtlmgrleallknygllycfnkdmskvstylrtvqcrsvegscgf