PDB entry 1hur

View 1hur on RCSB PDB site
Description:
Deposited on 1995-04-19, released 1995-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1hura_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1hurb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hurA (A:)
    gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
    sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
    lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hurB (B:)
    gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
    sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
    lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk