PDB entry 1huq

View 1huq on RCSB PDB site
Description: 1.8a crystal structure of the monomeric gtpase rab5c (mouse)
Class: protein transport
Keywords: G-protein, GTP hydrolysis, endocytosis, Rab protein, membrane trafficking, PROTEIN TRANSPORT
Deposited on 2001-01-04, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rab5c
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1huqa_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1huqA (A:)
    icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
    gqeryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
    askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl