PDB entry 1hup

View 1hup on RCSB PDB site
Description: human mannose binding protein carbohydrate recognition domain trimerizes through a triple alpha-helical coiled-coil
Class: c-type lectin
Keywords: alpha-helical coiled-coil, c-type lectin
Deposited on 1994-09-21, released 1995-10-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2738
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1hupa1, d1hupa2
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hupA (A:)
    aaserkalqtemarikkwltfslgkqvgnkffltngeimtfekvkalcvkfqasvatprn
    aaengaiqnlikeeaflgitdektegqfvdltgnrltytnwnegepnnagsdedcvlllk
    ngqwndvpcstshlavcefpi