PDB entry 1hup

View 1hup on RCSB PDB site
Description: human mannose binding protein carbohydrate recognition domain trimerizes through a triple alpha-helical coiled-coil
Deposited on 1994-09-21, released 1995-10-15
The last revision prior to the SCOP 1.65 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.3
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.65: d1hup_1, d1hup_2

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hup_ (-)
  aaserkalqtemarikkwltfslgkqvgnkffltngeimtfekvkalcvkfqasvatprn
  aaengaiqnlikeeaflgitdektegqfvdltgnrltytnwnegepnnagsdedcvlllk
  ngqwndvpcstshlavcefpi