PDB entry 1hum

View 1hum on RCSB PDB site
Description: solution structure of the chemokine hmip-1beta(slash)act-2 by multi-dimensional nmr: a novel chemokine dimer
Class: cytokine(chemotactic)
Keywords: cytokine(chemotactic)
Deposited on 1994-01-31, released 1994-04-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human macrophage inflammatory protein 1 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1huma_
  • Chain 'B':
    Compound: human macrophage inflammatory protein 1 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1humb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1humA (A:)
    apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
    eyvydleln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1humB (B:)
    apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
    eyvydleln