PDB entry 1hum

View 1hum on RCSB PDB site
Description: solution structure of the chemokine hmip-1beta(slash)act-2 by multi- dimensional nmr: a novel chemokine dimer
Deposited on 1994-01-31, released 1994-04-30
The last revision prior to the SCOP 1.59 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1huma_
  • Chain 'B':
    Domains in SCOP 1.59: d1humb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1humA (A:)
    apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
    eyvydleln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1humB (B:)
    apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
    eyvydleln