PDB entry 1hul

View 1hul on RCSB PDB site
Description: a novel dimer configuration revealed by the crystal structure at 2.4 angstroms resolution of human interleukin-5
Class: cytokine
Keywords: cytokine
Deposited on 1995-03-17, released 1995-12-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hula_
  • Chain 'B':
    Compound: Interleukin-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hulb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hulA (A:)
    iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
    verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hulB (B:)
    iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
    verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi