PDB entry 1hug

View 1hug on RCSB PDB site
Description: differences in anionic inhibition of human carbonic anhydrase i revealed from the structures of iodide and gold cyanide inhibitor complexes
Deposited on 1993-10-28, released 1994-04-30
The last revision prior to the SCOP 1.69 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1hug__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1hug_ (-)
    aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
    nvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
    ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
    pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
    mqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hug_ (-)
    wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
    sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
    sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
    lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
    nrptqplkgrtvrasf