PDB entry 1hue

View 1hue on RCSB PDB site
Description: histone-like protein
Class: DNA-binding
Keywords: DNA-binding
Deposited on 1995-05-26, released 1995-10-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hu protein
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A3H0 (0-89)
  Domains in SCOPe 2.02: d1huea_
• Chain 'B':
  Compound: hu protein
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A3H0 (0-89)
  Domains in SCOPe 2.02: d1hueb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hueA (A:)
  mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg
  rnpqtgeemeipaskvpafkpgkalkdavk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hueB (B:)
  mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg
  rnpqtgeemeipaskvpafkpgkalkdavk