PDB entry 1hu9

View 1hu9 on RCSB PDB site
Description: lipoxygenase-3 (soybean) complex with 4-hydroperoxy-2-methoxy-phenol
Class: oxidoreductase
Keywords: oxidoreductase, metalloprotein, fe(III) complex, purple lipoxygenase, enzyme inhibitor
Deposited on 2001-01-04, released 2003-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoxygenase-3
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09186 (Start-856)
      • see remark 999 (24)
      • see remark 999 (56)
      • see remark 999 (111)
      • see remark 999 (200)
      • see remark 999 (381)
      • see remark 999 (427)
      • see remark 999 (629)
    Domains in SCOPe 2.06: d1hu9a1, d1hu9a2
  • Heterogens: FE, 4HM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hu9A (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hu9A (A:)
    ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
    dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
    sltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnlr
    gdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdpn
    sesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdevh
    glysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefarem
    lagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlflld
    hhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvflp
    adegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykllh
    phyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikrg
    maiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqacw
    kelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrpt
    lsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerdn
    pnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegltf
    rgipnsisi