PDB entry 1hu9

View 1hu9 on RCSB PDB site
Description: lipoxygenase-3 (soybean) complex with 4-hydroperoxy-2-methoxy-phenol
Deposited on 2001-01-04, released 2003-06-03
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-03, with a file datestamp of 2003-06-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hu9A (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hu9A (A:)
    ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
    dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
    sltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnlr
    gdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdpn
    sesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdevh
    glysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefarem
    lagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlflld
    hhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvflp
    adegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykllh
    phyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikrg
    maiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqacw
    kelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrpt
    lsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerdn
    pnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegltf
    rgipnsisi