PDB entry 1hu3

View 1hu3 on RCSB PDB site
Description: middle domain of human eif4gii
Class: translation
Keywords: eIF4G, HEAT repeat
Deposited on 2001-01-03, released 2001-02-21
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.249
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eif4gii
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43432 (1-End)
      • cloning artifact (0)
      • modified residue (25)
      • modified residue (30)
      • modified residue (68)
      • modified residue (160)
      • modified residue (166)
      • modified residue (205)
      • modified residue (212)
      • modified residue (228)
    Domains in SCOP 1.73: d1hu3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hu3A (A:)
    sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
    sfsvayanmcrclvtlkvpmadkpgntvnfrklllnrcqkefekdkadddvfekkqkele
    aasapeertrlhdeleeakdkarrrsignikfigelfklkmlteaimhdcvvkllknhde
    esleclcrllttigkdldfekakprmdqyfnqmekivkerktssrirfmlqdvidlrlcn
    wvsrradqgpktieqihkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hu3A (A:)
    sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
    sfsvayanmcrclvtlkvpnfrklllnrcqkefekdkaakdkarrrsignikfigelfkl
    kmlteaimhdcvvkllknhdeesleclcrllttigkdldfekakprmdqyfnqmekivke
    rktssrirfmlqdvidlrlcnwvs