PDB entry 1hu3

View 1hu3 on RCSB PDB site
Description: middle domain of human eif4gii
Deposited on 2001-01-03, released 2001-02-21
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-21, with a file datestamp of 2001-02-21.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.249
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1hu3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hu3A (A:)
    sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
    sfsvayanmcrclvtlkvpmadkpgntvnfrklllnrcqkefekdkadddvfekkqkele
    aasapeertrlhdeleeakdkarrrsignikfigelfklkmlteaimhdcvvkllknhde
    esleclcrllttigkdldfekakprmdqyfnqmekivkerktssrirfmlqdvidlrlcn
    wvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hu3A (A:)
    sdpeniktqelfrkvrsilnkltpqmfnqlmkqvsgltvdteerlkgvidlvfekaidep
    sfsvayanmcrclvtlkvpnfrklllnrcqkefekdkaakdkarrrsignikfigelfkl
    kmlteaimhdcvvkllknhdeesleclcrllttigkdldfekakprmdqyfnqmekivke
    rktssrirfmlqdvidlrlcnwvs