PDB entry 1hu0

View 1hu0 on RCSB PDB site
Description: crystal structure of an hogg1-DNA borohydride trapped intermediate complex
Class: hydrolase/DNA
Keywords: DNA repair, DNA glycosylase, protein/DNA, borohydride, covalent trapping, product-assisted catalysis, reaction intermediate, hydrolase/DNA complex
Deposited on 2001-01-03, released 2003-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.21
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-oxoguanine DNA glycosylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (8-End)
      • cloning artifact (5-7)
    Domains in SCOPe 2.07: d1hu0a1, d1hu0a2, d1hu0a3
  • Chain 'D':
    Compound: 5'-d(*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*gp*c)-3'
  • Chain 'E':
    Compound: 5'-d(*gp*cp*gp*tp*cp*cp*ap*(ped)p*gp*tp*cp*tp*ap*cp*c)-3'
  • Heterogens: CA, OXG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hu0A (A:)
    amadigseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqv
    wtltqteeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqev
    aqkfqgvrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfps
    lqalagpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcil
    pgvgtkvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnff
    rslwgpyagwaqavlfsadlrqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hu0A (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkva
    dciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadlrq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.