PDB entry 1hty

View 1hty on RCSB PDB site
Description: golgi alpha-mannosidase II
Class: hydrolase
Keywords: N-terminal alpha-beta domain, three helix bundle, 2 C-terminal beta barrels, HYDROLASE
Deposited on 2001-01-02, released 2002-01-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-mannosidase II
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24451 (0-End)
      • modified residue (14)
      • modified residue (21)
      • modified residue (93)
      • modified residue (118)
      • modified residue (136)
      • modified residue (162)
      • modified residue (181)
      • modified residue (232-233)
      • modified residue (259)
      • modified residue (397)
      • modified residue (402)
      • modified residue (410)
      • modified residue (459)
      • modified residue (468)
      • modified residue (470)
      • modified residue (526)
      • modified residue (596)
      • modified residue (738)
      • modified residue (761)
      • modified residue (804)
      • modified residue (834)
      • modified residue (931)
      • modified residue (954)
      • modified residue (995)
      • modified residue (1003)
    Domains in SCOPe 2.08: d1htya1, d1htya2, d1htya3
  • Heterogens: NAG, ZN, TRS, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1htyA (A:)
    cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
    ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
    sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
    tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
    iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
    tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
    ragqaefptlsgdfftyadrsdnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdg
    marieerleqarrelslfqhhdgitgtakthvvvdyeqrmqealkacqmvmqqsvyrllt
    kpsiyspdfsfsyftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvd
    fyvsspfvsvtdlannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmgla
    tyvltisdskpehtsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafse
    qgllksiqltqdsphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkg
    klessvsvglpsvvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlng
    lqfikrrrldklplqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrl
    asdderglgqgvldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpld
    kfifaenewigaqgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtp
    eehtqkldvchllpnvarcerttltflqnlehldgmvapevcpmetaayvsshss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1htyA (A:)
    cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
    ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
    sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
    tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
    iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
    tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
    ragqaefptlsgdfftyadrsdnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdg
    marieerleqarrelslfqhhdgitgtakthvvvdyeqrmqealkacqmvmqqsvyrllt
    kpsiyspdfsfsyftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvd
    fyvsspfvsvtdlannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmgla
    tyvltisdskpehtsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafse
    qgllksiqltqdsphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkg
    klessvsvglpsvvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlng
    lqfikrrrldklplqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrl
    asdderglgqgvldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpld
    kfifaenewigaqgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtp
    eehtqkldvchllpnvarcerttltflqnlehldgmvapevcpmetaayvsshs