PDB entry 1htx

View 1htx on RCSB PDB site
Description: solution structure of the main alpha-amylase inhibitor from amaranth seeds
Class: plant protein
Keywords: cysteine knot
Deposited on 2001-01-02, released 2001-07-18
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-amylase inhibitor aai
  Species: Amaranthus hypochondriacus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80403 (0-31)
  Domains in SCOP 1.75: d1htxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1htxA (A:)
  cipkwnrcgpkmdgvpccepytctsdyygncs