PDB entry 1htq

View 1htq on RCSB PDB site
Description: Multicopy crystallographic structure of a relaxed glutamine synthetase from Mycobacterium tuberculosis
Class: ligase
Keywords: glutamine synthetase, Mycobacterium tuberculosis, multicopy refinement, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, LIGASE
Deposited on 2001-01-01, released 2002-07-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqa1, d1htqa2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqb1, d1htqb2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqc1, d1htqc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqd1, d1htqd2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqe1, d1htqe2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqf1, d1htqf2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqg1, d1htqg2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqh1, d1htqh2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqi1, d1htqi2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqj1, d1htqj2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqk1, d1htqk2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htql1, d1htql2
  • Chain 'M':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqm1, d1htqm2
  • Chain 'N':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqn1, d1htqn2
  • Chain 'O':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqo1, d1htqo2
  • Chain 'P':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqp1, d1htqp2
  • Chain 'Q':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqq1, d1htqq2
  • Chain 'R':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqr1, d1htqr2
  • Chain 'S':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqs1, d1htqs2
  • Chain 'T':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqt1, d1htqt2
  • Chain 'U':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqu1, d1htqu2
  • Chain 'V':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqv1, d1htqv2
  • Chain 'W':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqw1, d1htqw2
  • Chain 'X':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1htqx1, d1htqx2
  • Heterogens: MN, AMP, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqA (A:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqB (B:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqC (C:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqD (D:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqE (E:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqF (F:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqG (G:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqH (H:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqI (I:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqJ (J:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqK (K:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqL (L:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqM (M:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqN (N:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqO (O:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqP (P:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqQ (Q:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqR (R:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqS (S:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqT (T:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqU (U:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqV (V:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqW (W:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htqX (X:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv