PDB entry 1hto

View 1hto on RCSB PDB site
Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Deposited on 2001-01-01, released 2002-07-24
The last revision prior to the SCOP 1.63 freeze date was dated 2002-07-24, with a file datestamp of 2002-07-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoA (A:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoB (B:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoC (C:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoD (D:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoE (E:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoF (F:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoG (G:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoH (H:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoI (I:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoJ (J:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoK (K:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoL (L:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoM (M:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoN (N:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoO (O:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoP (P:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoQ (Q:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoR (R:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoS (S:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoT (T:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoU (U:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoV (V:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoW (W:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoX (X:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv