PDB entry 1htn

View 1htn on RCSB PDB site
Description:
Deposited on 1997-05-28, released 1997-12-03
The last revision prior to the SCOP 1.71 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1htn_1, d1htn_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1htn_ (-)
    gepptqkpkkivnakkdvvntkmfeelksrldtlsqevallkeqqalqtvclkgtkvhmk
    cflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlglndmaa
    egtwvdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlpyicqfg
    iv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1htn_ (-)
    lksrldtlsqevallkeqqalqtvclkgtkvhmkcflaftqtktfheasedcisrggtls
    tpqtgsendalyeylrqsvgneaeiwlglndmaaegtwvdmtgariayknweteitaqpd
    ggktencavlsgaangkwfdkrcrdqlpyicqfgiv