PDB entry 1htm

View 1htm on RCSB PDB site
Description: structure of influenza haemagglutinin at the ph of membrane fusion
Class: Viral protein
Keywords: INFLUENZA VIRUS HEMAGGLUTININ, Viral protein
Deposited on 1994-11-02, released 1995-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: uncultured beta proteobacterium UMTRA-608 [TaxId:140147]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: uncultured beta proteobacterium UMTRA-608 [TaxId:140147]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htmb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: uncultured beta proteobacterium UMTRA-608 [TaxId:140147]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: uncultured beta proteobacterium UMTRA-608 [TaxId:140147]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htmd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: uncultured beta proteobacterium UMTRA-608 [TaxId:140147]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: uncultured beta proteobacterium UMTRA-608 [TaxId:140147]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htmf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1htmB (B:)
    lkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynae
    llvalenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesirngty
    dhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1htmB (B:)
    stqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaell
    valenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesir
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1htmD (D:)
    lkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynae
    llvalenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesirngty
    dhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1htmD (D:)
    stqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaell
    valenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesirngtydh
    dvy
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1htmF (F:)
    lkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynae
    llvalenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesirngty
    dhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1htmF (F:)
    stqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaell
    valenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesirngtydh
    dvy