PDB entry 1htj

View 1htj on RCSB PDB site
Description: structure of the rgs-like domain from pdz-rhogef
Deposited on 2000-12-29, released 2001-07-11
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Domains in SCOP 1.57: d1htjf_

PDB Chain Sequences:

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1htjF (F:)
esdiifqdleklksrpahlgvflryifsqadpspllfylcaevyqqaspkdsrslgkdiw
nifleknaplrvkipemlqaeidsrlrnsedargvlceaqeaampeiqeqihdyrtkrtl
glgslygendlldldgdplrerqvaekqlaalgdilsayaadrsapmdfalntymshagi
rl