PDB entry 1hti

View 1hti on RCSB PDB site
Description: crystal structure of recombinant human triosephosphate isomerase at 2.8 angstroms resolution. triosephosphate isomerase related human genetic disorders and comparison with the trypanosomal enzyme
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1994-10-12, released 1995-01-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.167
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1htia_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1htib_
  • Heterogens: PGA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htiA (A:)
    apsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htiB (B:)
    apsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq