PDB entry 1hth

View 1hth on RCSB PDB site
Description: The solution structure of cyclic human parathyroid hormone fragment 1-34, NMR, 10 structures
Class: hormone
Keywords: human parathyroid hormone, cyclic, ornithine, norleucine, hormone
Deposited on 1997-04-09, released 1997-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclic parathyroid hormone
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01270 (0-33)
      • engineered (7)
      • engineered (12)
      • engineered (16-17)
    Domains in SCOPe 2.08: d1htha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hthA (A:)
    svseiqllhnlgahlnelervewlrkklqdvhnf