PDB entry 1htd

View 1htd on RCSB PDB site
Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (ht-d)
Deposited on 1994-01-20, released 1995-09-15
The last revision prior to the SCOP 1.69 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1htda_
  • Chain 'B':
    Domains in SCOP 1.69: d1htdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1htdA (A:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1htdA (A:)
    lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
    dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
    igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
    mhyyerflkqykpqcilnkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1htdB (B:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1htdB (B:)
    lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
    dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
    igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
    mhyyerflkqykpqcilnkp