PDB entry 1htb

View 1htb on RCSB PDB site
Description: crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c
Class: oxidoreductase
Keywords: nad+ dependent alcohol dehydrogenase, oxidoreductase
Deposited on 1995-08-10, released 1995-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.175
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta3 alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN BETA3 CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1htba1, d1htba2
  • Chain 'B':
    Compound: beta3 alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN BETA3 CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1htbb1, d1htbb2
  • Heterogens: ZN, CL, NAD, PYZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htbA (A:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksictvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htbB (B:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksictvltf